What is the catalog number for Ndufaf5 Antibody - middle region?

The catalog number for Ndufaf5 Antibody - middle region is ARP67035_P050-25UL.

What sizes are available for Ndufaf5 Antibody - middle region?

Ndufaf5 Antibody - middle region is available in the following size(s): 25 µL.

Is Ndufaf5 Antibody - middle region in stock?

Ndufaf5 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

Ndufaf5 Antibody - middle region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

NADH dehydrogenase (ubiquinone) complex I, assembly factor 5

Gene Aliases

2310003L22Rik

Gene ID

69487

Swiss Prot

A2APY7-2

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Ndufaf5

Target

Ndufaf5 is involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) at early stages. It may have methyltransferase activity.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DTMLAAAAVYREMYRNEDGSIPATFQIYHMI GWKYHDSQARPAERGSAT

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

17kDa

Protein Length

156

NCBI Gene Symbol

NDUFAF5

Host or Source

Rabbit

Protein Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5

Gene Name URL

Ndufaf5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVT44288 2 µg

pCMV-SPORT6-Emg1 Plasmid

View Details

MBS1028968-01 0.02 mg (E-Coli)

Recombinant Capsicum annuum 15-cis-phytoene desaturase, chloroplastic/chromoplastic (PDS)

View Details

MBS1028968-02 0.02 mg (Yeast)

Recombinant Capsicum annuum 15-cis-phytoene desaturase, chloroplastic/chromoplastic (PDS)

View Details

MBS1028968-03 0.1 mg (E-Coli)

Recombinant Capsicum annuum 15-cis-phytoene desaturase, chloroplastic/chromoplastic (PDS)

View Details

MBS1028968-04 0.1 mg (Yeast)

Recombinant Capsicum annuum 15-cis-phytoene desaturase, chloroplastic/chromoplastic (PDS)

View Details

MBS1028968-05 0.02 mg (Baculovirus)

Recombinant Capsicum annuum 15-cis-phytoene desaturase, chloroplastic/chromoplastic (PDS)

View Details