What is the catalog number for Lingo2 Antibody - C-terminal region?

The catalog number for Lingo2 Antibody - C-terminal region is ARP66848_P050-25UL.

What sizes are available for Lingo2 Antibody - C-terminal region?

Lingo2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Lingo2 Antibody - C-terminal region in stock?

Lingo2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Lingo2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Leucine rich repeat and Ig domain containing 2

Gene Aliases

LE, Lr, Lern3, Lrrn6c, B230217C06Rik

Gene ID

242384

Swiss Prot

Q3URE9

Accession Number

NP_780725

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Lingo2

Target

The function of this protein remains unknown.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol