What is the catalog number for RAB43 Antibody - C-terminal region (ARP66654_P050)?

The catalog number for RAB43 Antibody - C-terminal region (ARP66654_P050) is ARP66654_P050.

What sizes are available for RAB43 Antibody - C-terminal region (ARP66654_P050)?

RAB43 Antibody - C-terminal region (ARP66654_P050) is available in the following size(s): 100 µL.

Is RAB43 Antibody - C-terminal region (ARP66654_P050) in stock?

RAB43 Antibody - C-terminal region (ARP66654_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

RAB43 Antibody - C-terminal region (ARP66654_P050)

Selected Variant

ARP66654_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Aliases

RAB41, RAB11B

Gene ID

339122

Swiss Prot

Q86YS6

Accession Number

NP_940892.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB43

Target

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. RAB43 is involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. It plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWG

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

23 kDa

Protein Length

212

NCBI Gene Symbol

RAB43

Host or Source

Rabbit

Gene Name URL

RAB43

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant CDNF (Cerebral dopamine neurotrophic factor) protein, AF

PROTQ49AH0-2-5ug 5 µg