Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POF1B Antibody - N-terminal region (ARP66639_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Aliases

POF, POF2B

Gene ID

79983

Swiss Prot

Q8WVV4

Accession Number

NP_079197

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human POF1B

Target

Premature ovarian failure (POF) is characterized by primary or secondary amenorrhea in women less than 40 years old. Two POF susceptibility regions called "POF1" and "POF2" have been identified by breakpoint mapping of X-autosome translocations. POF1 extends from Xq21-qter while POF2 extends from Xq13.3 to Xq21.1. This gene, POF1B, resides in the POF2 region. This gene is expressed at trace levels in mouse prenatal ovary and is barely detectable or absent from adult ovary, in human and in the mouse respectively. This gene's expression is restricted to epithelia with its highest expression in the epidermis, and oro-pharyngeal and gastro-intestinal tracts. The protein encoded by this gene binds non-muscle actin filaments. The role this gene may play in the etiology of premature ovarian failure remains to be determined.

Partner Proteins

ESR1; COPS5; UBC; Cdk1; Akap12; Fam134a; Lyplal1; Tpr; UCHL5

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HYHCYHQSSQAQQPPEKNVVYERVRTYSGPMNKVVQALDPFNSREVLSPL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 86%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

65kDa

Protein Length

589

NCBI Gene Symbol

POF1B

Host or Source

Rabbit

Protein Name

Protein POF1B

Gene Name URL

POF1B

Nucleotide Accession Number

NM_024921

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF38A AAV siRNA Pooled Vector
37759161 1.0 µg

PRPF38A AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CADM2, NT (CADM2, IGSF4D, NECL3, Cell adhesion molecule 2, Immunoglobulin superfamily member 4D, Nectin-like protein 3, Synaptic cell adhesion molecule 2) (FITC) discontinued
033141-FITC 200 µL

CADM2, NT (CADM2, IGSF4D, NECL3, Cell adhesion molecule 2, Immunoglobulin superfamily member 4D, Nectin-like protein 3, Synaptic cell adhesion molecule 2) (FITC) discontinued

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)
MBS2041852-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)
MBS2041852-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)
MBS2041852-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)
MBS2041852-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Inhibin A (INHA)

Sign In for Pricing
View Details