What is the catalog number for MYCT1 Antibody - middle region?

The catalog number for MYCT1 Antibody - middle region is ARP66407_P050-25UL.

What sizes are available for MYCT1 Antibody - middle region?

MYCT1 Antibody - middle region is available in the following size(s): 25 µL.

Is MYCT1 Antibody - middle region in stock?

MYCT1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

MYCT1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Aliases

MTLC

Gene ID

80177

Swiss Prot

Q8N699

Accession Number

NP_079383

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MYCT1

Target

MYCT1 may regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. MYCT1 does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with MYC, including promotion of apoptosis, alteration of morphology, enhancement of anchorage-independent growth, tumorigenic conversion, promotion of genomic instability, and inhibition of hematopoietic differentiation.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTF

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol