What is the catalog number for FOLR2 Antibody - C-terminal region?

The catalog number for FOLR2 Antibody - C-terminal region is ARP65891_P050-25UL.

What sizes are available for FOLR2 Antibody - C-terminal region?

FOLR2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is FOLR2 Antibody - C-terminal region in stock?

FOLR2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

FOLR2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Aliases

FBP, FOLR1, FR-P3, FRbeta, FR-BETA, BETA-HFR, FBP/PL-1

Gene ID

2350

Swiss Prot

P14207

Accession Number

NP_000794

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FOLR2

Target

The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol