What is the catalog number for Arpc5 Antibody - N-terminal region?

The catalog number for Arpc5 Antibody - N-terminal region is ARP65408_P050-25UL.

What sizes are available for Arpc5 Antibody - N-terminal region?

Arpc5 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is Arpc5 Antibody - N-terminal region in stock?

Arpc5 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

Arpc5 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Actin related protein 2/3 complex, subunit 5, 16kDa

Gene Aliases

P16-, p16-Arc, 5830443F10Rik

Gene ID

67771

Swiss Prot

Q9CPW4

Accession Number

NP_080645

Reactivity

Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Arpc5

Target

Arpc5 functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Partner Proteins

Eed

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol