KRT6A Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Keratin 6A

Gene Aliases

K6A, K6C, K6D, PC3, CK6A, CK6C, CK6D, CK-6C, CK-6E, KRT6C, KRT6D

Gene ID

3853

Swiss Prot

P02538

Accession Number

NP_005545

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep

Target

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Partner Proteins

TRIM54; KRT40; TFIP11; HGS; KRT38; SGTA; KRT31; KRT15; KRT13; KIFC3; GOLGA2; TRIM23; LGR4; EED; KDM1A; PAN2; Iqcb1; Nphp4; Cep290; Nphp1; Invs; UBC; ITGA4; ALB; UBASH3B; SHC1; GRB2; EPS15; CRK; AP2M1; CBL; CUL1; COPS5; CUL2; CUL5; CCDC85B; TCHP; CCDC53; K

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKAD

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol