What is the catalog number for IFI30 Antibody - middle region (ARP64347_P050)?

The catalog number for IFI30 Antibody - middle region (ARP64347_P050) is ARP64347_P050.

What sizes are available for IFI30 Antibody - middle region (ARP64347_P050)?

IFI30 Antibody - middle region (ARP64347_P050) is available in the following size(s): 100 µL.

Is IFI30 Antibody - middle region (ARP64347_P050) in stock?

IFI30 Antibody - middle region (ARP64347_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

IFI30 Antibody - middle region (ARP64347_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Interferon, gamma-inducible protein 30

Gene Aliases

GILT, IP30, IP-30, IFI-30

Gene ID

10437

Swiss Prot

P13284

Accession Number

NP_006323

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IFI30

Target

The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing.

Partner Proteins

NOTCH2NL; KRTAP4-12

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol