Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DL2 Antibody - C-terminal region (ARP64058_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4

Gene Aliases

3DL2, p140, NKAT4, CD158K, NKAT-4, NKAT4B, KIR-3DL2

Gene ID

3812

Swiss Prot

P43630

Accession Number

NP_006728

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR3DL2

Target

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC) . The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2) . The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes.

Partner Proteins

Env; HLA-A

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

50kDa

Protein Length

455

NCBI Gene Symbol

KIR3DL2

Host or Source

Rabbit

Protein Name

Killer cell immunoglobulin-like receptor 3DL2

Gene Name URL

KIR3DL2

Nucleotide Accession Number

NM_006737

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CNOT1 shRNA Plasmid
abx982139-01 150 µg

Mouse CNOT1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CNOT1 shRNA Plasmid
abx982139-02 300 µg

Mouse CNOT1 shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral human SFPQ shRNA (UAS) - Lentiviral human SFPQ shRNA (UAS, RFP) (25)
GTR15335822 1 Vial

Lentiviral human SFPQ shRNA (UAS) - Lentiviral human SFPQ shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rat Erythropoietin receptor (EPOR) ELISA Kit
GA-E0302RT-01 48 Tests

Rat Erythropoietin receptor (EPOR) ELISA Kit

Sign In for Pricing
View Details
Rat Erythropoietin receptor (EPOR) ELISA Kit
GA-E0302RT-02 96 Tests

Rat Erythropoietin receptor (EPOR) ELISA Kit

Sign In for Pricing
View Details
hsa-miR-6782-5p miRNA Mimic
MBS8300274-01 5 nmol

hsa-miR-6782-5p miRNA Mimic

Sign In for Pricing
View Details