Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DS1 Antibody - C-terminal region (ARP63844_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Killer cell immunoglobulin like receptor, three Ig domains and short cytoplasmic tail 1

Gene Aliases

KIR-G1, NKAT10, CD158E2, NKAT-10, KIR-123FM

Gene ID

3813

Swiss Prot

Q14943

Accession Number

NP_001077008

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIR3DS1

Target

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC) . The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2) . The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Partner Proteins

TYROBP; HLA-B

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

42 kDa

Protein Length

387

NCBI Gene Symbol

KIR3DS1

Host or Source

Rabbit

Protein Name

Killer cell immunoglobulin-like receptor 3DS1

Gene Name URL

KIR3DS1

Nucleotide Accession Number

NM_001083539.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bombyx mori TATA-box-binding protein (Tbp)
MBS1168220-01 0.02 mg (E-Coli)

Recombinant Bombyx mori TATA-box-binding protein (Tbp)

Sign In for Pricing
View Details
Recombinant Bombyx mori TATA-box-binding protein (Tbp)
MBS1168220-02 0.02 mg (Yeast)

Recombinant Bombyx mori TATA-box-binding protein (Tbp)

Sign In for Pricing
View Details
Recombinant Bombyx mori TATA-box-binding protein (Tbp)
MBS1168220-03 0.1 mg (E-Coli)

Recombinant Bombyx mori TATA-box-binding protein (Tbp)

Sign In for Pricing
View Details
Recombinant Bombyx mori TATA-box-binding protein (Tbp)
MBS1168220-04 0.1 mg (Yeast)

Recombinant Bombyx mori TATA-box-binding protein (Tbp)

Sign In for Pricing
View Details
Recombinant Bombyx mori TATA-box-binding protein (Tbp)
MBS1168220-05 0.02 mg (Baculovirus)

Recombinant Bombyx mori TATA-box-binding protein (Tbp)

Sign In for Pricing
View Details
Recombinant Bombyx mori TATA-box-binding protein (Tbp)
MBS1168220-06 0.02 mg (Mammalian-Cell)

Recombinant Bombyx mori TATA-box-binding protein (Tbp)

Sign In for Pricing
View Details