What is the catalog number for DKK3 Antibody - N-terminal region?

The catalog number for DKK3 Antibody - N-terminal region is ARP63690_P050-25UL.

What sizes are available for DKK3 Antibody - N-terminal region?

DKK3 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is DKK3 Antibody - N-terminal region in stock?

DKK3 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

DKK3 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Dickkopf 3 homolog (Xenopus laevis)

Gene Aliases

RIG, REIC

Gene ID

27122

Swiss Prot

Q9UBP4

Accession Number

NP_056965

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit

Target

This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene.

Partner Proteins

UBQLN4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNT

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol