What is the catalog number for CD81 Antibody - C-terminal region?

The catalog number for CD81 Antibody - C-terminal region is ARP63231_P050-25UL.

What sizes are available for CD81 Antibody - C-terminal region?

CD81 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is CD81 Antibody - C-terminal region in stock?

CD81 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

CD81 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

CD81 molecule

Gene Aliases

S5.7, CVID6, TAPA1, TSPAN28

Gene ID

975

Swiss Prot

P60033

Accession Number

NP_001284578.1

Reactivity

Human, Cow, Dog, Goat, Horse, Pig, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CD81

Target

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol