Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens DNA-binding protein HU-beta (hupB)

Product Specifications

Abbreviation

Recombinant Pseudomonas fluorescens hupB protein

Gene Name

HupB

UniProt

Q9KHS6

Expression Region

1-90aa

Organism

Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

Target Sequence

MNKSELIDAIAASADLPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARIGRNPQTGKTLEIAAAKKPGFKAGKALKEAVN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.1 kDa

References & Citations

"A phospho-proteomic screen identifies substrates of the checkpoint kinase Chk1." Blasius M., Forment J.V., Thakkar N., Wagner S.A., Choudhary C., Jackson S.P. Genome Biol 12:R78-R78 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-100 1x 100 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF405S conjugate, 0.1mg/mL
BNC042886-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF405S conjugate, 0.1mg/mL
BNC041387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details