What is the catalog number for HSD17B8 Antibody - N-terminal region?

The catalog number for HSD17B8 Antibody - N-terminal region is ARP62143_P050-25UL.

What sizes are available for HSD17B8 Antibody - N-terminal region?

HSD17B8 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is HSD17B8 Antibody - N-terminal region in stock?

HSD17B8 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

HSD17B8 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Hydroxysteroid (17-beta) dehydrogenase 8

Gene Aliases

KE6, FABG, HKE6, FABGL, RING2, H2-KE6, SDR30C1, D6S2245E, dJ1033B10.9

Gene ID

7923

Swiss Prot

Q92506

Accession Number

NP_055049

Reactivity

Human

Target

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined.

Partner Proteins

RAD21

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVV

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol