Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK11A Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Cyclin-dependent kinase 11A

Gene Aliases

CDC2L2, CDC2L3, p58GTA, PITSLRE, CDK11-p46, CDK11-p58, CDK11-p110

Gene ID

728642

Swiss Prot

Q9UQ88

Accession Number

NP_277071

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Target

This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far.

Partner Proteins

UBC; CDC37; FKBP5; PIN1; CDK11A; HKR1; C18orf25; RBM25; ZFP14; PRPF40A; NOP58; ZNF510; ZNF460; ZNF267; ZNF33A; PSMD1; KPNA2; KPNB1; CSNK2B; CSNK2A2; CSNK2A1; CDKN2A; A2M; SOX2; Dlg4; GADD45A; HSP90AA1; SMAD3; SUMO2; CCNL1; SRSF7; RNPS1; KAT7; PAK1; CASP8

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

84kDa

Protein Length

767

NCBI Gene Symbol

CDK11A

Host or Source

Rabbit

Protein Name

Cyclin-dependent kinase 11A

Gene Name URL

CDK11A

Nucleotide Accession Number

NM_033529

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EGFR Knockout A549 cell line
GTR15418736 1 Vial

Human EGFR Knockout A549 cell line

Sign In for Pricing
View Details
Anti-AXL Antibody (8J860)
MF-0067215 100 µL

Anti-AXL Antibody (8J860)

Sign In for Pricing
View Details
Rabbit Polyclonal C9orf117 Antibody
NBP1-91072 0.1 mL

Rabbit Polyclonal C9orf117 Antibody

Sign In for Pricing
View Details
Anti-Collagen, Type IV antibody (monoclonal)
MBS175055-01 0.1 mg

Anti-Collagen, Type IV antibody (monoclonal)

Sign In for Pricing
View Details
Anti-Collagen, Type IV antibody (monoclonal)
MBS175055-02 5x 0.1 mg

Anti-Collagen, Type IV antibody (monoclonal)

Sign In for Pricing
View Details
Rsk-4 Antibody
AF9188-01 100 µL

Rsk-4 Antibody

Sign In for Pricing
View Details