What is the catalog number for Hprt Antibody - C-terminal region?

The catalog number for Hprt Antibody - C-terminal region is ARP61048_P050-25UL.

What sizes are available for Hprt Antibody - C-terminal region?

Hprt Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Hprt Antibody - C-terminal region in stock?

Hprt Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Hprt Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Hypoxanthine guanine phosphoribosyl transferase

Gene Aliases

Hpr, HPGRT, Hprt1, C81579

Gene ID

15452

Swiss Prot

P00492

Accession Number

NP_038584

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Target

Hprt converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Hprt transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Hprt plays a central role in the generation of purine nucleotides through the purine salvage pathway.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol