Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3f3a Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

H3 histone, family 3A

Gene Aliases

H3-3, H3.3, H3-3a, H3-3b, H3.3A, EyeLinc14

Gene ID

15078

Swiss Prot

P84244

Accession Number

NP_032236

Reactivity

Rat, Dog, Pig, Zebrafish

Target

H3f3a is a variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. H3f3a constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3f3a is deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Partner Proteins

Kmt2d; Chd5; Setd1a; Kmt2c; Setd1b; Ezh2; Chd1; Cbx3; Uhrf1; Nfkb2; Hdac5; Hdac3; Kdm6b; Nfe2; Aurka; Cbx2; Ehmt2; Cbx5; Aurkb; Cbx6; Bptf; Creb3l4; Ing2; Cbx7; Cbx8; Cbx4; Cd4; Fosb; Rps6ka5; Rps6ka3; Igh-8; Cd79a; Tcrb; Eif2s3x; Kdm5c; Nanog; Kcnq1ot1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Dog: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

15kDa

Protein Length

126

NCBI Gene Symbol

H3F3A

Host or Source

Rabbit

Protein Name

Histone H3.3

Gene Name URL

H3f3a

Nucleotide Accession Number

NM_008210

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL
BNC041983-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF405S conjugate, 0.1mg/mL
BNC042807-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL
BNC882053-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF640R conjugate, 0.1mg/mL
BNC400863-500 1x 500 µL

Glypican-3 (GPC3/863), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details