What is the catalog number for GNAT1 Antibody - N-terminal region (ARP59912_P050)?

The catalog number for GNAT1 Antibody - N-terminal region (ARP59912_P050) is ARP59912_P050.

What sizes are available for GNAT1 Antibody - N-terminal region (ARP59912_P050)?

GNAT1 Antibody - N-terminal region (ARP59912_P050) is available in the following size(s): 100 µL.

Is GNAT1 Antibody - N-terminal region (ARP59912_P050) in stock?

GNAT1 Antibody - N-terminal region (ARP59912_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

GNAT1 Antibody - N-terminal region (ARP59912_P050)

Selected Variant

ARP59912_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1

Gene Aliases

GBT1, GNATR, CSNB1G, CSNBAD3

Gene ID

2779

Swiss Prot

P11488

Accession Number

NP_653082.1

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAT1

Target

Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Partner Proteins

UBC; Haus1; RGS9; RGS16; F2R

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHM

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 77%; Rat: 100%; Sheep: 77%; Zebrafish: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38 kDa

Protein Length

350

NCBI Gene Symbol

GNAT1

Host or Source

Rabbit

Protein Name

Guanine nucleotide-binding protein G (t) subunit alpha-1

Gene Name URL