Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Antibody - C-terminal region (ARP59823_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Opsin 5

Gene Aliases

PGR12, GPR136, GRP136, TMEM13

Gene ID

221391

Swiss Prot

Q6U736

Accession Number

NP_859528

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OPN5

Target

Opsins are members of the guanine nucleotide-binding protein (G protein) -coupled receptor superfamily. This opsin gene is expressed in the eye, brain, testes, and spinal cord. This gene belongs to the seven-exon subfamily of mammalian opsin genes that includes peropsin (RRH) and retinal G protein coupled receptor (RGR) . Like these other seven-exon opsin genes, this family member may encode a protein with photoisomerase activity. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 92%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38 kDa

Protein Length

354

NCBI Gene Symbol

OPN5

Host or Source

Rabbit

Protein Name

Opsin-5

Gene Name URL

OPN5

Nucleotide Accession Number

NM_181744.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STAP-2
32-10274-500 500 µg

Recombinant Human STAP-2

Sign In for Pricing
View Details
Plant Peroxisome Proliferators Activator Alpha (PPAR-A) ELISA Kit
MBS9370889 Inquire

Plant Peroxisome Proliferators Activator Alpha (PPAR-A) ELISA Kit

Sign In for Pricing
View Details
BPHL Knockout HAP1 Polyclonal Cells
ARG27411 1 Million

BPHL Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor ELISA Kit
MBS736187-01 48 Well

Rat Vascular Endothelial cell Growth Factor ELISA Kit

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor ELISA Kit
MBS736187-02 96 Well

Rat Vascular Endothelial cell Growth Factor ELISA Kit

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor ELISA Kit
MBS736187-03 5x 96 Well

Rat Vascular Endothelial cell Growth Factor ELISA Kit

Sign In for Pricing
View Details