Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr806 Antibody - middle region (ARP59722_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Olfactory receptor, family 2, subfamily F, member 1

Gene ID

405331

Swiss Prot

D3ZFL4

Accession Number

NP_001000976

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Olr806

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34kDa

Protein Length

317

NCBI Gene Symbol

OLR806

Host or Source

Rabbit

Protein Name

Olfactory receptor 806 (Predicted) EMBL EDM15528.1

Gene Name URL

Olr806

Nucleotide Accession Number

NM_001000976

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB20 (Zinc Finger And BTB Domain-Containing Protein 20, Dendritic-Derived BTB/POZ Zinc Finger Protein, Zinc Finger Protein 288, DPZF, ZNF288)
407322-01 50 µL

ZBTB20 (Zinc Finger And BTB Domain-Containing Protein 20, Dendritic-Derived BTB/POZ Zinc Finger Protein, Zinc Finger Protein 288, DPZF, ZNF288)

Sign In for Pricing
View Details
ZBTB20 (Zinc Finger And BTB Domain-Containing Protein 20, Dendritic-Derived BTB/POZ Zinc Finger Protein, Zinc Finger Protein 288, DPZF, ZNF288)
407322-02 100 µL

ZBTB20 (Zinc Finger And BTB Domain-Containing Protein 20, Dendritic-Derived BTB/POZ Zinc Finger Protein, Zinc Finger Protein 288, DPZF, ZNF288)

Sign In for Pricing
View Details
Tmem29 (NM_001164684) Mouse Untagged Clone
MC214761 10 µg

Tmem29 (NM_001164684) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Human Nectin-2/PVRL2/CD112 Protein
RP00383-01 100 μg

Recombinant Human Nectin-2/PVRL2/CD112 Protein

Sign In for Pricing
View Details
Recombinant Human Nectin-2/PVRL2/CD112 Protein
RP00383-02 500 μg

Recombinant Human Nectin-2/PVRL2/CD112 Protein

Sign In for Pricing
View Details
Recombinant Human Nectin-2/PVRL2/CD112 Protein
RP00383-03 1000 μg

Recombinant Human Nectin-2/PVRL2/CD112 Protein

Sign In for Pricing
View Details