What is the catalog number for Uchl3 Antibody - middle region?

The catalog number for Uchl3 Antibody - middle region is ARP59298_P050-25UL.

What sizes are available for Uchl3 Antibody - middle region?

Uchl3 Antibody - middle region is available in the following size(s): 25 µL.

Is Uchl3 Antibody - middle region in stock?

Uchl3 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Uchl3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)

Gene ID

50933

Swiss Prot

Q9JKB1

Accession Number

NP_057932

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Uchl3

Target

Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Uchl3 has a 10-fold preference for Arg and Lys at position P3", and exhibits a preference towards 'Lys-48'-linked Ubiquitin chains. Uchl3 deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Uchl3 indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. It is required for stress-response retinal, skeletal muscle and germ cell maintenance. Uchl3 may be involved in working memory and can hydrolyze UBB (+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome.

Partner Proteins

Nedd8

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol