What is the catalog number for SERPINB6 Antibody - middle region?

The catalog number for SERPINB6 Antibody - middle region is ARP59249_P050-25UL.

What sizes are available for SERPINB6 Antibody - middle region?

SERPINB6 Antibody - middle region is available in the following size(s): 25 µL.

Is SERPINB6 Antibody - middle region in stock?

SERPINB6 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

SERPINB6 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Serpin peptidase inhibitor, clade B (ovalbumin), member 6

Gene Aliases

CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057

Gene ID

5269

Swiss Prot

P35237

Accession Number

NP_004559

Reactivity

Human, Cow

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SERPINB6

Target

The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin (ov) -serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.

Partner Proteins

SUMO2; C16orf70; AHCY; CRK; UBC; F10; PLAU; F2; PROC; PLG; KLK2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol