What is the catalog number for Atg7 Antibody - C-terminal region?

The catalog number for Atg7 Antibody - C-terminal region is ARP59072_P050-25UL.

What sizes are available for Atg7 Antibody - C-terminal region?

Atg7 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Atg7 Antibody - C-terminal region in stock?

Atg7 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

Atg7 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Autophagy related 7

Gene Aliases

Apg7l

Gene ID

312647

Swiss Prot

Q641Y5

Accession Number

NP_001012097

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Atg7

Target

Atg7 functions as an E1 enzyme essential for multisubstrates such as ATG8-like proteins and ATG12. It forms intermediate conjugates with ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A) . PE-conjugation to ATG8-like proteins is essential for autophagy. It also acts as an E1 enzyme for ATG12 conjugation to ATG5 and ATG3.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANI

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol