What is the catalog number for ULK3 Antibody - middle region?

The catalog number for ULK3 Antibody - middle region is ARP58971_P050-25UL.

What sizes are available for ULK3 Antibody - middle region?

ULK3 Antibody - middle region is available in the following size(s): 25 µL.

Is ULK3 Antibody - middle region in stock?

ULK3 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

ULK3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Unc-51-like kinase 3 (C. elegans)

Gene Aliases

DKFZp434C131, FLJ90566

Gene ID

25989

Swiss Prot

Q6PHR2

Accession Number

NP_001092906

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ULK3

Target

ULK3 is the serine/threonine protein kinase which enhances GLI1 and GLI2 transcriptional activity and consequently positively regulates GLI-dependent SHH signaling. ULK3 may exert this function by promoting GLI1 nuclear localization. ULK3 phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently.

Partner Proteins

VCP; WDR82; UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAI

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol