What is the catalog number for ATG4D Antibody - middle region?

The catalog number for ATG4D Antibody - middle region is ARP58865_P050-25UL.

What sizes are available for ATG4D Antibody - middle region?

ATG4D Antibody - middle region is available in the following size(s): 25 µL.

Is ATG4D Antibody - middle region in stock?

ATG4D Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

ATG4D Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

ATG4 autophagy related 4 homolog D (S. cerevisiae)

Gene Aliases

APG4D, AUTL4, APG4-D

Gene ID

84971

Swiss Prot

Q86TL0

Accession Number

NP_116274

Reactivity

Human, Mouse, Cow, Dog, Guinea Pig, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATG4D

Target

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.

Partner Proteins

UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol