Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90ab1 antibody - N-terminal region (ARP58844_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Heat shock protein 90 alpha (cytosolic), class B member 1

Gene Aliases

Hsp, 90kDa, Hsp84, Hsp90, Hspcb, C81438, Hsp84-1, AL022974

Gene ID

15516

Swiss Prot

P11499

Accession Number

NP_032328

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

Target

Hsp90ab1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

Partner Proteins

Isg15; Htt; HACE1; DNAJB2; Eed; Akt1; Hsp90ab1; Hsf1; Hdac6; UBQLN1; DSK2; Itgb1bp2; Mapk7; Pgr; Nr3c1; Vcp; CALM1; Stub1; Ptges3; Mks1; Iqcb1; Nphp4; Nphp1; Ahi1; Invs; CFTR; Nod2; Nr3c2; Nr1i3; Irf3; Ip6k2; PRKACB; Cdkn2a; Gcgr; Nod1; Chordc1; Slc34a1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

83kDa

Protein Length

724

NCBI Gene Symbol

HSP90AB1

Host or Source

Rabbit

Protein Name

Heat shock protein HSP 90-beta

Gene Name URL

Hsp90ab1

Nucleotide Accession Number

NM_008302

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PFKL Antibody
NBP2-32212 100 µL

Rabbit Polyclonal PFKL Antibody

Sign In for Pricing
View Details
LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (APC)
MBS6316076-01 0.2 mL

LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (APC)

Sign In for Pricing
View Details
LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (APC)
MBS6316076-02 5x 0.2 mL

LILRB1, ID (LILRB1, ILT2, LIR1, MIR7, Leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, CD85j) (APC)

Sign In for Pricing
View Details
Recombinant Sphingomyelin Phosphodiesterase 3 (SMPD3)
SIPG600Mu01-01 10 µg

Recombinant Sphingomyelin Phosphodiesterase 3 (SMPD3)

Sign In for Pricing
View Details
Recombinant Sphingomyelin Phosphodiesterase 3 (SMPD3)
SIPG600Mu01-02 50 µg

Recombinant Sphingomyelin Phosphodiesterase 3 (SMPD3)

Sign In for Pricing
View Details
Recombinant Sphingomyelin Phosphodiesterase 3 (SMPD3)
SIPG600Mu01-03 200 µg

Recombinant Sphingomyelin Phosphodiesterase 3 (SMPD3)

Sign In for Pricing
View Details