Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB5 antibody - N-terminal region (ARP58022_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Homeobox B5

Gene Aliases

HOX2, HU-1, HOX2A, Hox2.1, HHO.C10

Gene ID

3215

Swiss Prot

P09067

Accession Number

NP_002138

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5

Target

HOXB5 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB5 gene is included in a cluster of homeobox B genes located on chromosome 17.The protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

MAGEA11; CTBP2; CTBP1; TRIM23; UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

29kDa

Protein Length

269

NCBI Gene Symbol

HOXB5

Host or Source

Rabbit

Protein Name

Homeobox protein Hox-B5

Gene Name URL

HOXB5

Nucleotide Accession Number

NM_002147

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus psmA1 Protein (aa 1-21) (strain USA300)
VAng-Cr6059-1mgEcoli 1 mg (E. coli)

Recombinant Staphylococcus Aureus psmA1 Protein (aa 1-21) (strain USA300)

Sign In for Pricing
View Details
Rabbit Anti Human SEPT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424696-01 0.12 mL

Rabbit Anti Human SEPT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human SEPT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424696-02 5x 0.12 mL

Rabbit Anti Human SEPT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Mak (NM_001145802) Mouse Tagged ORF Clone Lentiviral Particle
MR218502L4V 200 µL

Mak (NM_001145802) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2) ELISA Kit
RK10802 96 Tests

Human Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2) ELISA Kit

Sign In for Pricing
View Details
Birc2 Mouse shRNA Lentiviral Particle (Locus ID 11797)
TL500114V 500 µL Each

Birc2 Mouse shRNA Lentiviral Particle (Locus ID 11797)

Sign In for Pricing
View Details