Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRM6 antibody - N-terminal region (ARP58004_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Glutamate receptor, metabotropic 6

Gene Aliases

MGlu6, CSNB1B, GPRC1F, MGLUR6

Gene ID

2916

Swiss Prot

O15303

Accession Number

NP_000834

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRM6

Target

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.

Partner Proteins

GNAO1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AGGLTLGGLFPVHARGAAGRACGQLKKEQGVHRLEAMLYALDRVNADPEL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 79%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

95kDa

Protein Length

877

NCBI Gene Symbol

GRM6

Host or Source

Rabbit

Protein Name

Metabotropic glutamate receptor 6

Gene Name URL

GRM6

Nucleotide Accession Number

NM_000843

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBM41 knockout cell line
ABC-KH12749 1 Vial

Human RBM41 knockout cell line

Sign In for Pricing
View Details
DPP10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV623768 1.0 µg DNA

DPP10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human Inhibin Beta C (INHbC) Protein
abx067202-01 10 µg

Human Inhibin Beta C (INHbC) Protein

Sign In for Pricing
View Details
Human Inhibin Beta C (INHbC) Protein
abx067202-02 50 µg

Human Inhibin Beta C (INHbC) Protein

Sign In for Pricing
View Details
Human Inhibin Beta C (INHbC) Protein
abx067202-03 100 µg

Human Inhibin Beta C (INHbC) Protein

Sign In for Pricing
View Details
Human Inhibin Beta C (INHbC) Protein
abx067202-04 200 µg

Human Inhibin Beta C (INHbC) Protein

Sign In for Pricing
View Details