What is the catalog number for TAF1C Antibody - N-terminal region?

The catalog number for TAF1C Antibody - N-terminal region is ARP57920_P050-25UL.

What sizes are available for TAF1C Antibody - N-terminal region?

TAF1C Antibody - N-terminal region is available in the following size(s): 25 µL.

Is TAF1C Antibody - N-terminal region in stock?

TAF1C Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

TAF1C Antibody - N-terminal region

Selected Variant

ARP57920_P050-25UL

Size: 25 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA box binding protein (TBP) -associated factor, RNA polymerase I, C, 110kDa

Gene Aliases

SL1, TAFI95, TAFI110, MGC:39976

Gene ID

9013

Swiss Prot

Q15572

Accession Number

NP_005670

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C

Target

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.

Partner Proteins

UBC; Tbp; Taf1b; Taf1a; UFD1L; TTR; TK1; SMN1; H2AFX; TAF12; TAF1D; POLR1E; RRN3; TRIM24; TP53; UBTF; CD3EAP; MYC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

95kDa

Protein Length

869

NCBI Gene Symbol

TAF1C

Host or Source

Rabbit

Protein Name

TATA box-binding protein-associated factor RNA polymerase I subunit C

Gene Name URL

TAF1C

Nucleotide Accession Number

NM_005679

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ferritin FTH1 Rabbit Monoclonal Antibody

M02401 100 µL/Vial