TAF1C antibody - N-terminal region (ARP57920_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA box binding protein (TBP) -associated factor, RNA polymerase I, C, 110kDa

Gene Aliases

SL1, TAFI95, TAFI110, MGC:39976

Gene ID

9013

Swiss Prot

Q15572

Accession Number

NP_005670

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C

Target

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.

Partner Proteins

UBC; Tbp; Taf1b; Taf1a; UFD1L; TTR; TK1; SMN1; H2AFX; TAF12; TAF1D; POLR1E; RRN3; TRIM24; TP53; UBTF; CD3EAP; MYC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol