What is the catalog number for Mapk9 antibody - N-terminal region (ARP57732_P050)?

The catalog number for Mapk9 antibody - N-terminal region (ARP57732_P050) is ARP57732_P050.

What sizes are available for Mapk9 antibody - N-terminal region (ARP57732_P050)?

Mapk9 antibody - N-terminal region (ARP57732_P050) is available in the following size(s): 100 µL.

Is Mapk9 antibody - N-terminal region (ARP57732_P050) in stock?

Mapk9 antibody - N-terminal region (ARP57732_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Mapk9 antibody - N-terminal region (ARP57732_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitogen-activated protein kinase 9

Gene Aliases

JNK, Prk, JNK2, Prkm9, AI851083, p54aSAPK

Gene ID

26420

Swiss Prot

Q9WTU6-2

Accession Number

NP_058657

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Mapk9 responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating a number of transcription factors, primarily components of AP-1 such as c-Jun and ATF2 and thus regulates AP-1 transcriptional activity. In T-cells, JNK1 and JNK2 are required for polarized differentiation of T-helper cells into Th1 cells.

Partner Proteins

Atf2; Dusp2; Mapkbp1; Mapk8ip3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol