What is the catalog number for GNB4 Antibody - middle region?

The catalog number for GNB4 Antibody - middle region is ARP57549_P050-25UL.

What sizes are available for GNB4 Antibody - middle region?

GNB4 Antibody - middle region is available in the following size(s): 25 µL.

Is GNB4 Antibody - middle region in stock?

GNB4 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

GNB4 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Guanine nucleotide binding protein (G protein), beta polypeptide 4

Gene Aliases

CMTD1F

Gene ID

59345

Swiss Prot

Q9HAV0

Accession Number

NP_067642

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNB4

Target

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Partner Proteins

UBC; SUMO2; GNG8; GNG12; GNG2; GNG13; GNGT1; GNG11; GNG10; GNG7; GNG5; GNG4; GNG3; FBXO6; CDK18; ADRB2; PAN2; MTNR1A; ESR1; GNAI3; GNAI2; GNAI1; PDCL; CEP97; RGS6; Haus1; Haus4; Mau2; Trim69; Cdk1; MTNR1B; GNGT2; git11

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol