What is the catalog number for Ppp2r3c Antibody - N-terminal region?

The catalog number for Ppp2r3c Antibody - N-terminal region is ARP57063_P050-25UL.

What sizes are available for Ppp2r3c Antibody - N-terminal region?

Ppp2r3c Antibody - N-terminal region is available in the following size(s): 25 µL.

Is Ppp2r3c Antibody - N-terminal region in stock?

Ppp2r3c Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

Ppp2r3c Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein phosphatase 2, regulatory subunit B'', gamma

Gene Aliases

RGD1309207

Gene ID

362739

Swiss Prot

Q6AXZ3

Accession Number

NP_001014218

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Target

Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol