What is the catalog number for UCHL5IP Antibody - middle region?

The catalog number for UCHL5IP Antibody - middle region is ARP56968_P050-25UL.

What sizes are available for UCHL5IP Antibody - middle region?

UCHL5IP Antibody - middle region is available in the following size(s): 25 µL.

Is UCHL5IP Antibody - middle region in stock?

UCHL5IP Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

UCHL5IP Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

HAUS augmin-like complex, subunit 7

Gene Aliases

UIP1, UCHL5IP

Gene ID

55559

Swiss Prot

Q99871

Accession Number

NP_996990

Reactivity

Human, Mouse, Cow, Dog, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP

Target

This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Partner Proteins

UBC; HAUS2; ATF4; DHX40; DHX29; MYC; HAUS6; Haus1; Haus4; UCHL5

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol