Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps36 antibody - N-terminal region (ARP56827_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Vacuolar protein sorting 36 (yeast)

Gene Aliases

Eap, Eap45, 1700010A24Rik, 2210415M20Rik, 2810408E15Rik

Gene ID

70160

Swiss Prot

Q91XD6

Accession Number

NP_081614

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Target

Vps36 is a component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns (3,4,5) P3.

Partner Proteins

Ubc

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SNKEPGPFQSSKNSYIRLSFKEHGQIEFYRRLSEEMTQRRWETVPVSQSL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

42kDa

Protein Length

386

NCBI Gene Symbol

VPS36

Host or Source

Rabbit

Protein Name

Vacuolar protein-sorting-associated protein 36

Gene Name URL

Vps36

Nucleotide Accession Number

NM_027338

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX10 Protein Vector (Rat) (pPB-N-His)
PV263467 500 ng

DDX10 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit
MBS2023225-01 24 Strip Well

Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details
Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit
MBS2023225-02 48 Well

Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details
Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit
MBS2023225-03 96 Well

Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details
Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit
MBS2023225-04 5x 96 Well

Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details
Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit
MBS2023225-05 10x 96 Well

Human Proteasome 26S Subunit, Non ATPase 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details