Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBP Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Myelin basic protein

Gene Aliases

MGC99675

Gene ID

4155

Swiss Prot

P02686

Accession Number

NP_001020272

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MBP

Target

The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. MBP induces T-cell proliferation.The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.

Partner Proteins

CTDSP1; MAP3K3; UBC; PRKCB; MAPK3; MAPK1; ULK1; SQSTM1; PKN1; HIPK2; MNAT1; CDK9; CDK8; CDK7; CCNT1; CCNH; CCNC; MELK; DDX58; MAPK14; AT4G38520; AT4G31860; AT4G28400; ABI1; RPS6KA6; TOPP8; AT5G24940; AT5G10740; AT5G06750; AT3G17250; AT3G02750; AT3G15260

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

Applications

IHC, IP, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 80%; Dog: 87%; Guinea Pig: 79%; Horse: 80%; Human: 100%; Mouse: 93%; Pig: 80%; Rabbit: 93%; Rat: 87%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

33kDa

Protein Length

304

NCBI Gene Symbol

MBP

Host or Source

Rabbit

Protein Name

Myelin basic protein

Gene Name URL

MBP

Nucleotide Accession Number

NM_001025101

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal BICD2 Antibody
NBP2-91999-0.1mL 0.1 mL

Rabbit Polyclonal BICD2 Antibody

Ask
View Details
SLC25A4 (NM_001151) Human Tagged ORF Clone Lentiviral Particle
RC209091L2V 200 µL

SLC25A4 (NM_001151) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
SH2B adapter protein 1 (SH2B1) Human ELISA Kit
H0204 96 Tests

SH2B adapter protein 1 (SH2B1) Human ELISA Kit

Ask
View Details
Recombinant Schizosaccharomyces pombe DNA endonuclease ctp1 (ctp1)
MBS1195161-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe DNA endonuclease ctp1 (ctp1)

Ask
View Details
Recombinant Schizosaccharomyces pombe DNA endonuclease ctp1 (ctp1)
MBS1195161-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe DNA endonuclease ctp1 (ctp1)

Ask
View Details
Recombinant Schizosaccharomyces pombe DNA endonuclease ctp1 (ctp1)
MBS1195161-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe DNA endonuclease ctp1 (ctp1)

Ask
View Details