Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS7 antibody - N-terminal region (ARP56147_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Ribosomal protein S7

Gene Aliases

S7, eS7, DBA8

Gene ID

6201

Swiss Prot

P62081

Accession Number

NP_001002

Reactivity

Human, Mouse, Rat, Dog, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPS7

Target

RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

RPS3; MDM2; HUWE1; ZBTB14; UBC; TP53; CEP76; TUBGCP3; CEP57; CDC37L1; RPA3; RPA2; RPA1; RNF2; EED; FAU; DDX3X; PSMC4; WIBG; EIF2A; WDR26; PNO1; TSR1; RPS27L; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

22kDa

Protein Length

194

NCBI Gene Symbol

RPS7

Host or Source

Rabbit

Protein Name

40S ribosomal protein S7

Gene Name URL

RPS7

Nucleotide Accession Number

NM_001011

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin E (CTSE) Antibody
abx032873-01 80 µL

Cathepsin E (CTSE) Antibody

Sign In for Pricing
View Details
Cathepsin E (CTSE) Antibody
abx032873-02 400 µL

Cathepsin E (CTSE) Antibody

Sign In for Pricing
View Details
Recombinant Human CXCL7 / C-X-C Motif Chemokine Ligand 7, Animal Free & Carrier Free
C-CYP379-500ug 500 µg

Recombinant Human CXCL7 / C-X-C Motif Chemokine Ligand 7, Animal Free & Carrier Free

Sign In for Pricing
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)
MBS6250423-01 0.1 mL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)

Sign In for Pricing
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)
MBS6250423-02 5x 0.1 mL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)

Sign In for Pricing
View Details
Guinea pig Myosin (Myo) ELISA Kit
MBS269644-01 48 Well

Guinea pig Myosin (Myo) ELISA Kit

Sign In for Pricing
View Details