What is the catalog number for ILDR1 Antibody - middle region?

The catalog number for ILDR1 Antibody - middle region is ARP55751_P050-25UL.

What sizes are available for ILDR1 Antibody - middle region?

ILDR1 Antibody - middle region is available in the following size(s): 25 µL.

Is ILDR1 Antibody - middle region in stock?

ILDR1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

ILDR1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Immunoglobulin-like domain containing receptor 1

Gene Aliases

DFNB42, ILDR1beta, ILDR1alpha, ILDR1alpha'

Gene ID

286676

Swiss Prot

Q86SU0-2

Accession Number

NP_787120

Reactivity

Human, Mouse, Rat, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Target

ILDR1 is a putative membrane receptor.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol