Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Amyloid beta (A4) precursor protein-binding, family B, member 1

Gene Aliases

Rir, Fe65

Gene ID

11785

Swiss Prot

Q9QXJ1

Accession Number

NP_033815

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Apbb1 is an adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain.Apbb1 plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. Apbb1 may act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Apbb1 is required for histone H4 acetylation at double-strand breaks (DSBs) . Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity.Apbb1 functions in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Apbb1 is associates with chromatin in a region surrounding the CASP4 transcriptional start site (s) .

Partner Proteins

Rnf157; Enah; Prnp; APP; APLP2; APLP1; Evl

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

78kDa

Protein Length

708

NCBI Gene Symbol

APBB1

Host or Source

Rabbit

Protein Name

Amyloid beta A4 precursor protein-binding family B member 1

Gene Name URL

Apbb1

Nucleotide Accession Number

NM_009685

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-500 1x 500 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF568 conjugate, 0.1mg/mL
BNC682387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF405S conjugate, 0.1mg/mL
BNC042475-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details