What is the catalog number for CCNDBP1 antibody - middle region (ARP55415_P050)?

The catalog number for CCNDBP1 antibody - middle region (ARP55415_P050) is ARP55415_P050.

What sizes are available for CCNDBP1 antibody - middle region (ARP55415_P050)?

CCNDBP1 antibody - middle region (ARP55415_P050) is available in the following size(s): 100 µL.

Is CCNDBP1 antibody - middle region (ARP55415_P050) in stock?

CCNDBP1 antibody - middle region (ARP55415_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

CCNDBP1 antibody - middle region (ARP55415_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cyclin D-type binding-protein 1

Gene Aliases

HHM, DIP1, GCIP

Gene ID

23582

Swiss Prot

O95273

Accession Number

NP_411241

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1

Target

This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene.

Partner Proteins

TYMSOS; ZNRF2P1; C6orf226; FAM74A4; ZNF564; ZNF555; TMEM120B; TRAPPC5; RPL39L; ZNF670; NEURL3; ZNF697; ZNF439; C22orf23; ZGPAT; ZNF394; RBP5; FAM110A; THAP7; TTC23; DMRT3; ARHGAP22; CCDC146; ZNF490; THAP10; IMP3; FAM64A; ZNF581; MRPL15; CNNM3; SYF2; NUDCD

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

26kDa

Protein Length

232

NCBI Gene Symbol

CCNDBP1

Host or Source

Rabbit

Gene Name URL