Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK19 Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Cyclin-dependent kinase 19

Gene Aliases

CDK11, DEE87, CDC2L6, EIEE87, bA346C16.3

Gene ID

23097

Swiss Prot

Q9BWU1-2

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK19

Target

This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex.

Partner Proteins

MED6; MED13; MED12; MED24; MED20; MED7; MED22; MASP1; MED1; PIP; CLU; CCNC; AZGP1; APOD; MED17; MED23; MED14; MED11; MED8; MED30; MED28; MED29; MED9; MED18; MED15; MED31; MED4; MED13L; CDK19; ERC1; MED16; MED27; MED19; MED26; NIFK; RNPC3; COMMD4; CUTA; MY

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

48kDa

Protein Length

442

NCBI Gene Symbol

CDK19

Host or Source

Rabbit

Protein Name

Cyclin-dependent kinase 19

Gene Name URL

CDK19

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
BNC740018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details