Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frataxin/FXN, Cynomolgus (His)

Frataxin (FXN) protein activates persulfide transfer, which is critical for [2Fe-2S] cluster assembly. It accelerates sulfur transfer from NFS1 persulfide to ISCU and small thiols, resulting in oversulfide and sulfide release. Frataxin/FXN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived Frataxin/FXN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Frataxin/FXN Protein, Cynomolgus (His), Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/frataxin-protein-cynomolgus-his.html

Purity

90.0

Smiles

SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA

Molecular Formula

102120656 (Gene_ID) Q8HXX9 (S81-A210) (Accession)

Molecular Weight

Approximately 22 kDa.The reducing (R) protein migrat es as 22 kDa in SDS-PAGE may be due to relative charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPNA5 Rabbit Polyclonal Antibody
orb2953713-01 50 µg

KPNA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KPNA5 Rabbit Polyclonal Antibody
orb2953713-02 100 µg

KPNA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4064) [Alexa Fluor 405]
NBP3-08606AF405 100 µL

Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4064) [Alexa Fluor 405]

Sign In for Pricing
View Details
CCDC153 HDR Plasmid (m)
sc-435410-HDR 20 µg

CCDC153 HDR Plasmid (m)

Sign In for Pricing
View Details
NLN Knockout MES-OV Polyclonal Cells
ARG6477 1 Million

NLN Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Anti-ADAM9 antibody
STJ27341 100 µl

Anti-ADAM9 antibody

Sign In for Pricing
View Details