Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOXL1 antibody - N-terminal region (ARP54780_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Lysyl oxidase-like 1

Gene Aliases

LOL, LOXL

Gene ID

4016

Swiss Prot

Q08397

Accession Number

NP_005567

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOXL1

Target

LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

ATXN1; CUL2; FBLN5; ELN

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 83%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

63 kDa

Protein Length

574

NCBI Gene Symbol

LOXL1

Host or Source

Rabbit

Protein Name

Lysyl oxidase homolog 1

Gene Name URL

LOXL1

Nucleotide Accession Number

NM_005576

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr6 (NM_031392) Mouse Tagged ORF Clone
MG211670 10 µg

Wdr6 (NM_031392) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SPDE7 rabbit pAb
ES19343-01 50 µL

SPDE7 rabbit pAb

Sign In for Pricing
View Details
SPDE7 rabbit pAb
ES19343-02 100 µL

SPDE7 rabbit pAb

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Probable lipid kinase YegS-like (XAC0475)
MBS1344517-01 0.02 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri Probable lipid kinase YegS-like (XAC0475)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Probable lipid kinase YegS-like (XAC0475)
MBS1344517-02 0.02 mg (Yeast)

Recombinant Xanthomonas axonopodis pv. citri Probable lipid kinase YegS-like (XAC0475)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Probable lipid kinase YegS-like (XAC0475)
MBS1344517-03 0.1 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri Probable lipid kinase YegS-like (XAC0475)

Sign In for Pricing
View Details