Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpsa antibody - N-terminal region (ARP54682_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Ribosomal protein SA

Gene Aliases

L, La, MLR, P40, 67lr, Lamr, P40-, 67kDa, Lamr1, P40-3, P40-8, Lamrl1, AL022858

Gene ID

16785

Swiss Prot

P14206

Accession Number

NP_035159

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.

Partner Proteins

Eed; Rara; Rpgrip1l; Tcf3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

32kDa

Protein Length

295

NCBI Gene Symbol

RPSA

Host or Source

Rabbit

Protein Name

40S ribosomal protein SA

Gene Name URL

Rpsa

Nucleotide Accession Number

NM_011029

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTLP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV761697 1.0 µg DNA

FTLP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)
MBS1047773-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)
MBS1047773-02 0.1 mg (E-Coli)

Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)
MBS1047773-03 0.02 mg (Yeast)

Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)
MBS1047773-04 0.1 mg (Yeast)

Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)
MBS1047773-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas putida Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details