Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1

Gene Aliases

Gi

Gene ID

2770

Swiss Prot

P63096

Accession Number

NP_002060

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNAI1

Target

Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1) ; and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311) ; and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]) . Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180) .[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

GPSM3; RGS17; ESR1; ATP4A; RAD52; SVIL; NUCB1; NCF2; MTNR1B; MTNR1A; NCF1; THAP7; RIC8A; RGS14; IQCB1; UBC; RANGAP1; GPR50; GNB1; GNAI3; GNAI2; GNB4; GNB2; PTH1R; PCK1; Haus1; Cep76; Haus4; Recql4; Trim69; Cbx1; PGR; STRN; KLHL3; ADCY5; RASD1; CRHR1; GPSM

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 100%; Zebrafish: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

40kDa

Protein Length

354

NCBI Gene Symbol

GNAI1

Host or Source

Rabbit

Protein Name

Guanine nucleotide-binding protein G (i) subunit alpha-1

Gene Name URL

GNAI1

Nucleotide Accession Number

NM_002069

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)
MBS1147479-01 0.02 mg (E-Coli)

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)

Ask
View Details
Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)
MBS1147479-02 0.1 mg (E-Coli)

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)

Ask
View Details
Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)
MBS1147479-03 0.02 mg (Yeast)

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)

Ask
View Details
Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)
MBS1147479-04 0.1 mg (Yeast)

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)

Ask
View Details
Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)
MBS1147479-05 0.02 mg (Baculovirus)

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)

Ask
View Details
Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)
MBS1147479-06 0.02 mg (Mammalian-Cell)

Recombinant Oligotropha carboxidovorans 2-phospho-L-lactate guanylyltransferase (cofC)

Ask
View Details