Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAU Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed

Gene Aliases

S30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta

Gene ID

2197

Swiss Prot

P62861

Accession Number

NP_001988

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAU

Target

FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) . It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

TP53; UBC; RPS17; rev; WIBG; PNO1; TSR1; PA2G4; RPSA; HDLBP; BYSL; RPS27L; G3BP1; DYNLL1; SPTAN1; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS13; RPS9; RPS7; RPS6; RPS4X; RPS3; RPL18; PTBP1; ICAM1; CD81; IGSF8

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

8 kDa

Protein Length

133

NCBI Gene Symbol

FAU

Host or Source

Rabbit

Protein Name

40S ribosomal protein S30

Gene Name URL

FAU

Nucleotide Accession Number

NM_001997

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL28 Receptor alpha (IFNLR1) Rabbit Polyclonal Antibody
TA346514 100 µL

IL28 Receptor alpha (IFNLR1) Rabbit Polyclonal Antibody

Ask
View Details
Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit
MBS7231936-01 48 Well

Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit

Ask
View Details
Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit
MBS7231936-02 96 Well

Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit

Ask
View Details
Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit
MBS7231936-03 5x 96 Well

Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit

Ask
View Details
Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit
MBS7231936-04 10x 96 Well

Bovine Cysteine-rich PDZ-binding protein (CRIPT) ELISA Kit

Ask
View Details
Human EXOC1 shRNA Plasmid
abx960900-01 150 µg

Human EXOC1 shRNA Plasmid

Ask
View Details