What is the catalog number for Dnaja1 Antibody - N-terminal region?

The catalog number for Dnaja1 Antibody - N-terminal region is ARP54580_P050-25UL.

What sizes are available for Dnaja1 Antibody - N-terminal region?

Dnaja1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is Dnaja1 Antibody - N-terminal region in stock?

Dnaja1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

Dnaja1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

DnaJ (Hsp40) homolog, subfamily A, member 1

Gene Aliases

Hsj, Hsj2, Nedd, HSJ-2, Nedd7

Gene ID

15502

Swiss Prot

P63037

Accession Number

NP_032324

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Dnaja1 is a co-chaperone of Hsc70. Dnaja1 seems to play a role in protein import into mitochondria.

Partner Proteins

Nanog; Lrp1b; Iqcb1; Htt; SOD1; Atxn3; Pou5f1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol