Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD26L Antibody - N-terminal region (ARP54401_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

ERCC excision repair 6 like 2

Gene Aliases

HEBO, BMFS2, SR278, RAD26L, C9orf102

Gene ID

375748

Swiss Prot

Q5T890-2

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD26L

Target

This gene encodes a member of the Snf2 family of helicase-like proteins. The encoded protein may play a role in DNA repair and mitochondrial function. Mutations in this gene have been associated with bone marrow failure syndrome 2. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Partner Proteins

C7orf49; NEK6

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57kDa

Protein Length

523

NCBI Gene Symbol

ERCC6L2

Host or Source

Rabbit

Protein Name

DNA excision repair protein ERCC-6-like 2

Gene Name URL

ERCC6L2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr383 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV633257 1.0 µg DNA

Olr383 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)
MBS1454264-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)
MBS1454264-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)
MBS1454264-03 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)
MBS1454264-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)
MBS1454264-05 0.02 mg (Baculovirus)

Recombinant Oryza sativa subsp. japonica REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 (Os05g0151300, LOC_Os05g05940)

Sign In for Pricing
View Details