Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pias2 antibody - N-terminal region (ARP53839_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein inhibitor of activated STAT 2

Gene Aliases

Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6

Gene ID

17344

Swiss Prot

Q8C5D8-4

Accession Number

NP_001157639

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Target

Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor.Pias2 plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing may vary depending upon the biological context and PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing.Pias2 binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIASx-beta, but not isoform PIASx-alpha, promotes MDM2 sumoylation. Isoform PIASx-alpha promotes PARK7 sumoylation. Isoform PIASx-beta promotes NCOA2 sumoylation more efficiently than isoform PIASx-alpha

Partner Proteins

Pparg; Egr2; Plagl2; Trim32; Trp53; DHX9; Nfkb1; Gtf2i; GTF2IRD1; HDAC3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PAVQIKIRELYRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

63kDa

Protein Length

580

NCBI Gene Symbol

PIAS2

Host or Source

Rabbit

Protein Name

E3 SUMO-protein ligase PIAS2

Gene Name URL

Pias2

Nucleotide Accession Number

NM_001164167

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Respiratory Syncytial Virus A2 Antibody
NB100-93588 0.1 mg

Rabbit Polyclonal Respiratory Syncytial Virus A2 Antibody

Sign In for Pricing
View Details
Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit
MBS7203877-01 48 Well

Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit

Sign In for Pricing
View Details
Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit
MBS7203877-02 96 Well

Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit

Sign In for Pricing
View Details
Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit
MBS7203877-03 5x 96 Well

Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit

Sign In for Pricing
View Details
Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit
MBS7203877-04 10x 96 Well

Goat Cytochrome P450 3A43 (CYP3A43) ELISA Kit

Sign In for Pricing
View Details
SC-79, Akt activator
TBI1468-5MG 5 mg

SC-79, Akt activator

Sign In for Pricing
View Details